claim
Genetically engineered or 'designer' proteins will provide many benefits for our health and/or the environment.
How to write a scientific essay
research questions
Senior School Database Search
 |
CRAAP
jstor
- JStor This link opens in a new window
JSTOR is a digital library of academic journals, books, and primary sources relevant to all subjects.
Web of Science
- Web of Science This link opens in a new window
Web of Science delivers access to scholarly works across the Sciences, Social Sciences, Arts and Humanities. Access is limited to on site unless you register for roaming access. Registration remains current for 6 months after which you must reregister.
science direct
- Elsevier Science Direct This link opens in a new window
Access to this database is permitted only from school; no username and password necessary. Search for peer-reviewed journals, articles, book chapters and open access content which includes scientific, technical, and medical research in the sciences, social sciences and humanities. There are three editions to Science Direct, currently we subscribe to the College Edition Journals Collection - Physical Sciences.
Data Sets
google scholar
Google Google Scholar Tutorials
Citemaker
Citemaker Tutorials
Bibliography Help
Note-Taking
national library
state library
uq borrowing
sources
Sources to get you started ...
- Scientists Advance on One of Technology’s Holy Grails"CIEQSFTTLFACQTAAEIWRAFGYTVKIMVDNGNCRLHVC: these forty letters are a set of instructions for building a sophisticated medical device designed to recognize the flu virus in your body ... "
- This protein designer aims to revolutionize medicines and materials" ... But head inside to his lab and it’s quickly apparent that the computational biochemist is far from satisfied with what nature offers, at least when it comes to molecules ... "
- Designer proteins"Enabled by decades of basic research, the rise of inexpensive computing, and the genomics revolution in reading and writing DNA, scientists can now design new proteins from scratch with specific functions ... "
Search Engines and Databases for Science
Search Engines and Databases for Science
- Core"CORE’s mission is to aggregate all open access research worldwide and deliver unrestricted access for all."
- PLOS One"PLOS One is a peer-reviewed open access scientific journal published by the Public Library of Science (PLOS) since 2006. The journal covers primary research from any discipline within science and medicine."
- arXiv"arXiv is a free distribution service and an open-access archive for 1,895,728 scholarly articles in the fields of physics, mathematics, computer science, quantitative biology, quantitative finance, statistics, electrical engineering and systems science, and economics. Materials on this site are not peer-reviewed by arXiv."
- Science Daily"ScienceDaily features breaking news about the latest discoveries in science, health, the environment, technology, and more -- from leading universities, scientific journals, and research organizations."
- Live Science"For the science geek in everyone, Live Science breaks down the stories behind the most interesting news and photos on the Internet, while also digging up fascinating discoveries that hit on a broad range of fields, from dinosaurs and archaeology to wacky physics and astronomy to health and human behavior."
- The Conversation"The Conversation Australia and New Zealand is a unique collaboration between academics and journalists that in just 10 years has become the world’s leading publisher of research-based news and analysis."
- Science Tech Daily"Read daily science news articles for students, teachers, and researchers. Find the latest science news and interesting research articles."
- SciCentral"Since 1997, the SciCentral editors have been aggregating breaking research news from the most reputable and reliable sources ... Only content freely accessible to online readers is considered."
- Google Books"On Google Books, you can read books and magazines, download them, cite them, and translate them. Some books are provided by publishers, while others are scanned as part of the Library Project." When you load a book, enter the keywords for the specific information you need in the Search in this book box. Although the entire book may not load, you may still be able to extract some relevant information.